General Information

  • ID:  hor006759
  • Uniprot ID:  Q6UWQ7
  • Protein name:  Insulin growth factor-like family member 2
  • Gene name:  IGFL2
  • Organism:  Homo sapiens (Human)
  • Family:  IGFL family
  • Source:  Human
  • Expression:  Detected in cerebellum, heart, placenta, spleen, stomach, testis and thymus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding
  • GO BP:  GO:0008150 biological_process
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  PAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP
  • Length:  94
  • Propeptide:  MVPRIFAPAYVSVCLLLLCPREVIAPAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP
  • Signal peptide:  MVPRIFAPAYVSVCLLLLCPREVIA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potential ligand of the IGFLR1 cell membrane receptor.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  IGFLR1
  • Target Unid:  Q9H665
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6UWQ7-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006759_AF2.pdbhor006759_ESM.pdb

Physical Information

Mass: 1215099 Formula: C456H700N126O137S11
Absent amino acids: M Common amino acids: CPS
pI: 6.91 Basic residues: 10
Polar residues: 35 Hydrophobic residues: 25
Hydrophobicity: -30.64 Boman Index: -15347
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 60.11
Instability Index: 5874.79 Extinction Coefficient cystines: 14605
Absorbance 280nm: 157.04

Literature

  • PubMed ID:  16890402
  • Title:  IGFL: A secreted family with conserved cysteine residues and similarities to the IGF superfamily.
  • PubMed ID:  12975309
  • Title:  The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
  • PubMed ID:  15057824
  • Title:  The DNA sequence and biology of human chromosome 19.
  • PubMed ID:  21454693
  • Title:  Murine insulin growth factor-like (IGFL) and human IGFL1 proteins are induced in inflammatory skin conditions and bind to a novel tumor necrosis factor receptor family member, IGFLR1.